| | | | | | . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 |
| # |
Score |
Template |
Links and tools | %id | First |
GSSGSSGFKAELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGFPEGSVELYAEKVATRGSGPSSG | Last |
| 1 | -54.500 | d1wh9a_ d.52.3.1 (A:) Ribosomal protein S3 N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} |
ali model 3D-neighbors |
100 | 1 | GSSGSSGFKAELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGFPEGSVELYAEKVATRGSGPSSG |
92 |
| 2 | -34.100 | d2uubc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]} |
ali model 3D-neighbors follow.. |
21 | 28 | .YRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTG---KNVALNVQEV.......... |
105 |
| 3 | -10.300 | d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
14 | 6 | ....................................IRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLA......... |
52 |
| 4 | -10.300 | d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} |
ali model 3D-neighbors follow.. |
13 | 10 | ....................................EEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQIAPDS.................. |
47 |
| 5 | -10.300 | d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} |
ali model 3D-neighbors follow.. |
23 | 10 | ....................................QEIMIPASKAGLVIGKGGETIKQLQERAGVKMVMIQDG.................. |
47 |
| 6 | -10.100 | d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
15 | 5 | ....................................VEMAVPENLVGAILGKGGKTLVEYQELTGARIQISKKG.................. |
42 |
| 7 | -10.100 | d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
19 | 6 | ....................................TQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDE.................... |
41 |
| 8 | -9.930 | d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} |
ali model 3D-neighbors follow.. |
15 | 11 | ..............................ENTPVFEQLSVPQRSVGRIIGRGGETIRSICKASGAKITCDKES.................. |
54 |
| 9 | -9.770 | d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
15 | 1 | ..................................QEFNFIVPTGKTGLIIGKGGETIKSISQQSGARIELQRNP.................. |
40 |
| 10 | -9.720 | d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
18 | 5 | ....................................IDVPIPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDD.................. |
42 |
| 11 | -9.520 | d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
16 | 6 | ..............................ALVPVTIEVEVPFDLHRYVIGQKGSGIRKMMDEFEVNIHVPAPELQSDIIAIT......... |
58 |
| 12 | -9.360 | d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
16 | 3 | ...........................VARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKIT......... |
58 |
| 13 | -9.120 | d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
15 | 12 | ....................................LSVTVDPKYHPKIIGRKGAVITQIRLEHDVNIQFPDKD.................. |
49 |
